DPCstruct | MC18553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 254 ± 30 aa |
| Standard deviation of domain lengths | 30.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AS07 | 2-242 | CNNIDSDKTRRIIQRASVESRPNDVTLLQQIGLKKFTAQFFTVPPSFMKEVIHMACSKHEQQLQCGSVFEGDEVTRRRIEDLRTLGN… |
| Q95QS2 | 30-331 | SIVYDRLPKELLGEARKFGAKAYKDFLYATENATARERINVYEDYFMECNTLGHERAERVFQNVYNIKLTKDMKLLLTLGFNSFAAR… |
| A0A2H2IGY6 | 41-278 | None |
| A0A811K0V1 | 70-313 | None |
| A0A1I7SA90 | 21-330 | None |
| A0A0K0DD93 | 6-206 | None |
| A0A6G0V1X0 | 306-551 | None |
| A0A6G0V088 | 2-266 | None |
| A0A6G0UVD3 | 67-309 | None |
| A0A3P8AKQ3 | 105-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.