DPCstruct | MC18550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419FW09 | 1-97 | MKRKKIPYGTKLPVKLTLRDRDLIRDETLGNPDFAKFAVVEGKGIRVDMSLDDIEEVQGYVAAAANHTENKKLQKELDQLFKKLQVF… |
| A0A1F4FM05 | 5-103 | KRKRLKPGEKVALSLTLAQVDLIVEHIFLSEGLLATIHAARVQDNIVRTRCTLGELDELAGCVAAKAKDTKDRRFQKELGAISEAIA… |
| A0A0S8GNX2 | 152-254 | None |
| A0A4P5UF00 | 312-424 | None |
| A0A2N2NS38 | 1-85 | None |
| A0A3M1IUB4 | 1-112 | None |
| A0A1G3PS78 | 160-253 | None |
| A0A538UAV3 | 2-95 | None |
| X8APB2 | 14-108 | None |
| A0A6N7C7U5 | 98-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.