DPCstruct | MC1855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 245 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6KWH8 | 412-657 | FDSYWKFIDNSREMNKHLRCTNQNKFPSEYNLINEIEYESEFGYMKFWEEKAILDGVEIFSPFMQIWVFPPKEFIKEDFRRAMEKCT… |
| A0A2D5UZ32 | 3-243 | GLYRDIVDNARRINDAQRCLKDNNMPNVELLSLEGDYEFGQIKLWEEESTREGYPIVSTYMQLFIFPPQEVMKEELLQAGKEQRMPG… |
| A0A7J4M6Y6 | 399-634 | None |
| A0A2G9LR84 | 240-466 | None |
| A0A7C1RAM0 | 205-446 | None |
| A0A842UX47 | 322-558 | None |
| A0A2H9RM26 | 38-273 | None |
| A0A842U1B6 | 1-290 | None |
| A0A7J4RCQ3 | 736-980 | None |
| A0A7J4IZR8 | 975-1221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.