DPCstruct | MC18548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 3.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A503HU34 | 1-52 | MTAYEARPDYQKNDYLGWIARAKRPDTRQKRLDQMLDELQRGGVYMNIGWHG |
| A0A501WZ55 | 31-85 | LEDNNLMEDYLERPAYQQNDYIGWINQAKQEATKQKRLNQMLVELKQGGVYMKMA |
| A0A520Y0S1 | 9-66 | None |
| A0A7Y5DGS9 | 108-166 | None |
| A0A316H1B4 | 18-73 | None |
| A0A7C3VRY0 | 2-59 | None |
| A0A2H0QXF9 | 13-79 | None |
| S4XN31 | 82-136 | None |
| A0A142LYJ7 | 18-75 | None |
| A0A1V5JTW7 | 22-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.