DPCstruct | MC18547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N8ZNX5 | 13-122 | PKPLSSGVVFRQGSRTNKNMTPRLGKDTNPARKPGLSTTIEQPIDGKYQMLDVEKLNKNGLDVIQDDLDHASIRPKDDPTLEKLNEW… |
| A0A503HPE5 | 26-126 | AVVYRDGSATLANLTPKAKDIDTGLSARMAPVPGKNQVIDPAKFENLCAVCDNAVTGHVSIAPIDKSLMQGWIDSRDTLDNINAAVH… |
| A0A374US83 | 126-224 | None |
| A0A0D0Q6K7 | 87-184 | None |
| A0A4R2YYX4 | 64-166 | None |
| A0A0K2NX63 | 195-290 | None |
| A0A085UBP2 | 2-104 | None |
| A0A1B9MYQ4 | 63-172 | None |
| A0A7Y5SKB9 | 1-113 | None |
| A0A0J1IHN6 | 177-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.