DPCstruct | MC18546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 50.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CR32 | 1-114 | LQCNLTGVLTHDEHVNKLDPSYSKGIQSPGRHVRTRLYFTSESHVHSLLTIIRYGGLLNISTDEQWKRSMDYLDTVSELNYLTQIVI… |
| A0A453H3M2 | 463-562 | VKTPDRHVRTRLYFTSESHIHSLMNVLRYCNLDESLHGEDSLVCQSTLDRLHRTRELDYMSNIVLRMFENTEVPLEDEKRFRIEMTF… |
| A0A445DC01 | 186-298 | None |
| A0A1E7FIS7 | 3-117 | None |
| H2ZSV8 | 74-178 | None |
| A0A835R4H9 | 195-307 | None |
| A0A4Y2GDS4 | 195-332 | None |
| B9EQY0 | 3-101 | None |
| A0A7S0MV09 | 88-194 | None |
| A0A7S2YUD1 | 127-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.