DPCstruct | MC18544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 116 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 76.17 |
| Assigned Pfam label(s) | CL0229- CL0257- PF02135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CJU6 | 11-114 | IPSHPAVNDINDLIECDLMDTGNVFLSFACDKNYEFSSLRRAKFSTMGLLYELHTSTTEKFIYSCNTCRQQCDIRYHCTICEDFDLC… |
| A0A820G7H2 | 12-116 | ISYPTVNDTNDLVQCDLMNSGNTFLNFARNENYEFSSLRRAKFSTMALLYELHTSATNKFTYYCNTCQQECDIHFHCALCEDFDLCE… |
| A0A2P4YSK5 | 73-227 | None |
| A0A2P4YRA1 | 74-201 | None |
| A0A820T2W6 | 78-259 | None |
| A0A2G3CEJ9 | 4-125 | None |
| A0A1B0BU47 | 26-130 | None |
| A0A7S2RDY8 | 280-411 | None |
| A0A7R9U6P2 | 958-1053 | None |
| A0A0L9UT52 | 492-605 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.