DPCstruct | MC18543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 47.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819YTX3 | 131-227 | IQKSLESSTSSLQIIYTYTQIYHTIDHLPADVEEVKLSAFRTELELVKKVKHHYQALTNFRLLLIRVDYHGEHQHILSLKHVVQNEY… |
| A0A822CC83 | 1-98 | MVQQALENDHISPQIIYTYIQIFYRIETLPNGVKEINLSTFKTELELKNKIKDHYQQSNTIRLLLIRVDYHNEHQHILSLKHVLLNE… |
| A0A814PLH5 | 136-227 | None |
| A0A817NCN6 | 193-292 | None |
| A0A817PFF7 | 368-468 | None |
| A0A818B218 | 139-229 | None |
| A0A817S3B9 | 2-105 | None |
| A0A818JVU8 | 681-788 | None |
| A0A819FYH6 | 44-145 | None |
| A0A817FDJ4 | 71-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.