DPCstruct | MC18542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 103 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0QC84 | 44-130 | VNLVLAVVLKELSGTLLLKIKRPPTNRLWFGFTAMPHLVLDLEPVVSTRQIKWALVLKPIESRIREVVMESIVYPNLDDLVFFDTQP |
| A0A822CAP9 | 21-112 | KKLFEKFSEDDVGADIEITSFSGVLTLNIPPPPSDRIWVGFPELPGLNIKVTPTYGEKHYCYTLLEDFLAAKIKAELKRVVVLPAMD… |
| A0A058Z0A4 | 38-120 | None |
| J9FC55 | 1-90 | None |
| A0A7S4KNI2 | 256-350 | None |
| A0A7S4JMD8 | 42-148 | None |
| T0LYW9 | 34-125 | None |
| R0LZY7 | 62-143 | None |
| A0A834ILD4 | 567-672 | None |
| A0A2H9TMR9 | 231-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.