DPCstruct | MC18540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 209 ± 24 aa |
| Standard deviation of domain lengths | 23.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 88.24 |
| Assigned Pfam label(s) | CL0433- CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZIE1 | 132-411 | ALTLGPLDYVRVRDAMDGTERAVHGPRLFFLGPYEKMQASGQGVSVSNMQYVLIEDKQTGERKVQRGPLVWIPGPREEGKVCNAVRL… |
| A0A822BXG1 | 1-192 | MGCCKSTQYGCCIAIDHDESIILNKPTGKEIRYGPGWFCFPNWWDAQVMKSIPLQNNQYIIVKHIIDTDDKNAFHARNDIPLTQRTT… |
| A0A7J7ZXN8 | 1-174 | None |
| A0A2H1BV94 | 8-193 | None |
| A0A2V2V3C4 | 18-238 | None |
| A0A812UG54 | 115-328 | None |
| A0A812SYK5 | 7-187 | None |
| L8GWT3 | 28-265 | None |
| A0A813FVX3 | 100-275 | None |
| A0A6G3Z6Z4 | 7-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.