DPCstruct | MC1854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 158 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9L7F2 | 7-142 | ETSANENQIIKMVKDSAHQIWLAGLGAFAKTQQEGNKLFDSLVTEGEKIESRTKKSAEDKLETVKSKVADNSTWDRLEQVFENRVSR… |
| A0A840MK02 | 5-158 | KKNAPQKQLTSVIVDSANQIWLAGLGALARAQVEGNKVFDALVDAGRKIEEEGKRIAGERVGEAAGKAVETWDKLETVFQDRVARSL… |
| A0A2V7YFH0 | 6-151 | None |
| A0A1G4A946 | 10-193 | None |
| A0A7V8BHZ2 | 30-188 | None |
| A0A1E4IGL1 | 7-181 | None |
| A0A2R7PXG4 | 2-160 | None |
| A0A522SIS5 | 52-200 | None |
| A0A0G3BXU4 | 7-153 | None |
| A0A5B8N7S2 | 37-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.