DPCstruct | MC18539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 397 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819XCS6 | 228-633 | IITPKYIQDINNIQNILMIYARMSLEISSLRRYTVDNLEKLRPIINLLTSILALYDEPSKVFQMIMTKYITTNHLNTCTSIDACINH… |
| A0A822BNQ3 | 109-505 | IITPKYIQGINNIQNILVIYARMSLEISNLRRYTVNNLEKLKPIINLLTSILALYNEPPKVFQMIMTDYITANRLNTCTNIDACITH… |
| A0A817N6G9 | 2-380 | None |
| A0A815S034 | 4-404 | None |
| A0A817NRM7 | 145-538 | None |
| A0A820SDJ5 | 225-633 | None |
| A0A817FWY3 | 57-471 | None |
| A0A820NGV4 | 386-803 | None |
| A0A815F027 | 192-605 | None |
| A0A815NY35 | 2-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.