DPCstruct | MC18538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822BN35 | 5-167 | VSNFGLTWVEFSSRYRQVVQRIQKMRQSEYKQFIFNINETRDFLTTEKRLTTIFKTLSFNDKLDANELEKFFECCDLSATSYEIKEA… |
| A0A3M7QSC4 | 1013-1180 | KLVLYRENVDWSSFTTNYRKTILRILKMRNSFSIDCEFIPNEALDFYLREKKYTSYFNKLAFSNEIELSDISKMFNFVDLHPNNDEI… |
| A0A6P5KWH6 | 8-186 | None |
| M3Y6M6 | 166-363 | None |
| A0A7M5V0J1 | 66-234 | None |
| R0K4J2 | 220-385 | None |
| A0A1S3A2X6 | 284-485 | None |
| A0A2C9M665 | 196-363 | None |
| A0A7J8I800 | 2-162 | None |
| A0A821DJP7 | 25-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.