DPCstruct | MC18536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 172 ± 44 aa |
| Standard deviation of domain lengths | 44.09 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0431- CL0612 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226EK45 | 561-763 | INIFALLHHAHLSARKMKLRHFRNNQELPWIKNDENYDFEYQQTRPLTDSIVVLPGDHLTTECIYDTTWRDGTTIGGLATRDEMCQS… |
| A0A822BJS2 | 19-162 | RLTEPIQLYFGDEFATRCVYNTMNKTHITLGGETVHNEMCLHIFAYYPRMNTPSICLNLISTLSWEMFMKRNLSSTFNYEEFEEWLM… |
| A0A151NL65 | 321-574 | None |
| A0A816SUX8 | 103-264 | None |
| A0A401RLD0 | 355-506 | None |
| A0A816WCC3 | 91-274 | None |
| A0A1D2N304 | 18-212 | None |
| A0A182FBG8 | 256-486 | None |
| A0A820DRP1 | 18-167 | None |
| A0A819TYW5 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.