DPCstruct | MC18533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 333 |
|---|---|
| Mean domain length (aa) | 187 ± 35 aa |
| Standard deviation of domain lengths | 34.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 59.59 |
| Assigned Pfam label(s) | CL0040- CL0094- PF02272- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2R1Z2 | 8-131 | YRLMRLHFAAELVLEHVYQFFHHPEKIGANINEDKARIDFYWEGSIATIFPELTQRVNQMITEDLPIISAFSDEQNQRRYWRIEGFA… |
| A0A533VU45 | 440-623 | DTGKLGGGRVLEVLKEGEEIFHVLDQPPSFKVGDSVRGILDWERRYRIMKMHTTAHILSAIVNRETGALITGNQIGPEESRLDLSLE… |
| A0A380QCL3 | 294-500 | None |
| R5IML2 | 150-298 | None |
| A0A1E3H6T4 | 419-616 | None |
| A0A803Q536 | 238-461 | None |
| A0A6J7I4Z3 | 152-417 | None |
| A0A0R3U1J9 | 79-311 | None |
| B6DTC6 | 631-819 | None |
| A0A7M5V147 | 115-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.