DPCstruct | MC18532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 271 ± 79 aa |
| Standard deviation of domain lengths | 78.80 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 85.61 |
| Assigned Pfam label(s) | CL0534- CL0101- CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S8RG51 | 10-145 | SGIDAHPDSLDDEALEEKARSILDDYEEGLLAAWRERFGTLRAQGLATDSLDDVAVAAANAAIDELLFDMDSSAEGTIDDRGRVERA… |
| A0A533VQH6 | 278-581 | FENELAKARSSNASSERLGLLQETVAQLRMIYQSELILAKVKSVRWKRNLRNDKFIDIELPVTRSFVGNGFVLHNSARRYERGREME… |
| D3QB08 | 90-402 | None |
| A0A6V7PBY3 | 82-451 | None |
| A0A846W0M6 | 53-344 | None |
| A0A843F865 | 8-185 | None |
| I1CD42 | 1-184 | None |
| A0A7J9T2H3 | 19-220 | None |
| Q74ML3 | 79-304 | None |
| R7WQC0 | 81-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.