DPCstruct | MC1853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397Q347 | 4-136 | AVPWIAVALIVYDIAVFGFAGAGVAGAQAVMQSEIVTIPLMSGARWSLGVGDAIVLLTLVFLFVELMKAARRRGISITDQALSTIIL… |
| A0A1W9L7B4 | 1-99 | MSATMMSGAAWSATMGDVLIILGVFCLYVELFKATRTTVASIVDHAISLAVFVIFLVEFIIIKGAGTSTFLILGLMSLLDVVAGFTI… |
| A0A5M6ZMJ8 | 43-143 | None |
| A0A7X4A7P4 | 1-160 | None |
| A0A1V5KZF8 | 87-186 | None |
| A0A2U2BR15 | 1-164 | None |
| A0A4Q5WFV1 | 9-144 | None |
| A0A3E1ECY4 | 110-218 | None |
| A0A521VTJ3 | 3-126 | None |
| A8IJI2 | 99-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.