DPCstruct | MC18528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 16 aa |
| Standard deviation of domain lengths | 16.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5RMW4 | 2-133 | TFGAISSIQNNEQGEPSWIISGHWITNIINKTMDSFNQTNPAKFDSWVYMVMLDGTAMHKHSISNFSLSDVSNQDNATSYKGTVTVT… |
| A0A533VAJ2 | 23-173 | NDSKVLAANDTFSAHGQISSLVLGMPPSTHTINMSSVEKFILSSNWKLVTDKGKIANFTSEFYTGPINGANNHTHLLTNLRIPDDKP… |
| A0A5B2YWW7 | 33-169 | None |
| A0A838VYI4 | 17-137 | None |
| A0A1Q7FAV9 | 5-178 | None |
| A0A484IAV7 | 97-246 | None |
| A0A7W1DNL2 | 22-173 | None |
| A0A6A7LG78 | 30-183 | None |
| A0A533VFF5 | 45-203 | None |
| A0A842PWH6 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.