DPCstruct | MC18526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842Q7S7 | 1-74 | YIDPVFSWQIPPADTDIEFLRSSKLGDKSANNIFVGDNNNGNVYYFQVNEDRSGIKFDASQTGLIDLVADNEEE |
| A0A533V8H5 | 12-87 | NDFNGSGRYSCPEFIWYTPVCVTSLTFLDSNKLGKQYQNDLFVGDFHTGNLYHFDLDEKRTKLSLDSPLKDKIANN |
| A0A7V9DIC2 | 38-130 | None |
| A0A5B2Z5T6 | 878-949 | None |
| A0A5B2YWV9 | 512-594 | None |
| A0A5B2YTU9 | 1-89 | None |
| A0A838N591 | 153-244 | None |
| A0A5B2Z3K3 | 1-101 | None |
| A0A075GPQ5 | 254-343 | None |
| A0A533UXM2 | 388-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.