DPCstruct | MC18525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4WXD2 | 2-88 | KAIAPNNLEITGTLEVVRGRGLITFCGPDEEGEETEGHLSFNLDGETEMFWEEQRTARTEEGLCVFLDEDGGEWTEKDITLVPDCFG |
| A0A5M3Q232 | 1-80 | MKEFVSPQGNEIIGTLETVPGVALIDMDSASLEGDTLQFDYDGQTDIQWNEQKTVRRSGHRVFVDDRDNEFTEDQLHFID |
| A0A0Q5XF26 | 8-87 | None |
| A0A119APB5 | 1-80 | None |
| A0A105V3Q2 | 1-77 | None |
| A0A1I3RRM5 | 1-75 | None |
| A0A441DCM7 | 1-80 | None |
| A0A2A6NRF2 | 6-100 | None |
| A0A1C0SX71 | 77-154 | None |
| A0A0A3XHB8 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.