DPCstruct | MC18523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5PSL9 | 85-167 | SGQPNPETLIYIETGSVQCEADGVSEQETAQLLTNSGIPVLATNCGELTRPVAAQCGMPGPDINLHLIPTQRVDQARAMGFKL |
| A0A3C0ICB4 | 10-111 | IFLLLLILLPLSSCGRRQTRYVLMTTAEVLCPDQWRQGSTDEQTIRNISDTLSQNGIGHINTRFDGQSQTTCQACGCTTGRRILVEV… |
| A0A845D8E3 | 167-254 | None |
| A0A4P5W665 | 140-223 | None |
| A0A3M1CRZ0 | 338-444 | None |
| A0A7G6SVR6 | 94-179 | None |
| A0A246FFU2 | 2-99 | None |
| A0A1W9I3U3 | 3-85 | None |
| A0A6L8UBJ3 | 62-147 | None |
| A0A1F3XTI9 | 210-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.