DPCstruct | MC18520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 186 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0471- PF21113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7KN72 | 43-183 | ANAIAAQADFKVGISSVYPHPFTAWGGGAKIILPGICHVSSLHHHHGKLPGRARGTDPGRCPARRDLDEAAVLFGLDRAVCAVIGGS… |
| A0A3A0HTK2 | 4-157 | QYGCDVYLNKDYVESDFKIVTGFIEPHFFAGFSGGPKGIMPGIAGIETIMTFHNAKMIGDIRSTWGNMQDNPVQNMTREINAMCKPD… |
| A0A7C6DQU6 | 77-261 | None |
| A0A1Y4CGP2 | 136-327 | None |
| X1LNZ4 | 1-172 | None |
| X1LJP6 | 94-267 | None |
| A0A7E4SF04 | 836-995 | None |
| A0A2S0VYC4 | 289-501 | None |
| A0A812VK18 | 95-308 | None |
| A0A4R5JIA9 | 140-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.