DPCstruct | MC1852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1BGI5 | 2-77 | KNKECAISIAERTALKYNLDLLDDAVYLRKINLQFENKRLVFYRVYSFDYNTQNSDDRYRGYIVIRNGRLDDVVLE |
| A0A1W9L3U3 | 3-88 | LGVGFWLDTQWTYAIAITLCRRVCAELGLQLLDDTVALIRIRLKRNAQGRLTFQRAYTFEVTERGGNSRHNGMLLMRGKVLEMVEL |
| K7ADV0 | 3-78 | None |
| A0A011PAH0 | 310-399 | None |
| A0A3C0HIV8 | 78-174 | None |
| A0A432W0L2 | 11-106 | None |
| A0A7Y3F1G4 | 1-87 | None |
| A0A829Y815 | 3-101 | None |
| A0A127FBQ5 | 3-101 | None |
| A0A846ZI85 | 6-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.