DPCstruct | MC18513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 208 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1TZH9 | 1-234 | GRAPPQRGGVMATCFAGGEPVTRKEPEPVVWQESLKKDGDGKRCLLYGDTEDGAVMVAPKGSDKWVTLHELNRVRRDGADGARQVSD… |
| A0A7S2CWR4 | 103-286 | AKTGPVPKGWDCTISTEEDPTPCLIMGEVPYGCKSVAPDGSGKWVSLWEFNSMRREEPHKISSLWYDQFSLKCEELNLHLGPVGYIL… |
| W7TIY3 | 229-437 | None |
| I7ISV9 | 102-326 | None |
| A0A1G4GYN2 | 259-472 | None |
| A0A4D9D8S7 | 11-211 | None |
| A0A077Y7X5 | 41-255 | None |
| A0A7S2LN90 | 11-201 | None |
| A0A2T7IGB0 | 700-899 | None |
| A0A6H5KUK4 | 187-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.