DPCstruct | MC18511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 32.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7TR18 | 330-513 | HVAQLFYAIAFSAAHSWPQMLPGLLTLLGSLTEPRALLLQATVAILVYNFSYDHPYLLADNRHFTFYIWKRFLALPSLRCSFSPLYV… |
| A0A7S1TUT1 | 41-206 | FSKSTLNEIWFLFTATPAALLCVIGGGSWLLAKYSFSHPFLLADNRHLTFYLWKGLLAKPQARLLLGAAYCVAGILGMRRLSRCQGF… |
| E9IBS0 | 57-241 | None |
| A0A0D2QBQ7 | 41-233 | None |
| A0A838ZXZ0 | 80-289 | None |
| A0A1Y1VZT2 | 1-143 | None |
| A0A812JK71 | 463-655 | None |
| A0A6C1E7E1 | 851-1127 | None |
| A0A0E9NLY6 | 276-466 | None |
| A0A5N6JTT4 | 646-915 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.