DPCstruct | MC18510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 126 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U4H457 | 17-135 | FRAPLKVGGKVGSRVARLPARAVAPSVTALSARKAAEEEIDFWQGDWVCADCGYIYDRGECNGLYFEEQPRGFRCPQCRGPRRRYAK… |
| A0A2W1JWL6 | 1-108 | MSSETKTNTSLKRYECKSCGYVYEPKEGDSRRDIPVGTPFEELPEDWTCPVCRAETKQFMDIGSVGAPSGFQENLGYGIGVNSLTPG… |
| A0A6P6B230 | 14-159 | None |
| I1I2U1 | 58-203 | None |
| A0A835PUG8 | 27-132 | None |
| A0A7S4C8I3 | 136-244 | None |
| A0A7R9UJY1 | 21-149 | None |
| K8ETI6 | 2-159 | None |
| M1UPH1 | 76-231 | None |
| A0A218XW95 | 128-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.