DPCstruct | MC18508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 387 ± 113 aa |
| Standard deviation of domain lengths | 113.27 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 73.45 |
| Assigned Pfam label(s) | CL0029- CL0184- CL0378- PF03441- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4G7C1 | 4-208 | SLRDELWVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARIFHQQLKAILKRQSKHSQPPVSLIGQLLWREFYYTVAAAEPNFDRML… |
| A0A351ZU47 | 25-378 | GAEYLLPVYDWDPAVRMGPHRAAYLLASLASLQRDLRARGSDLLFRLQPPDEQVRHLYRQAETLYHVDDLPMTLERLPGVFTSFRRD… |
| A0A7T7C1S6 | 15-317 | None |
| A0A292RTF7 | 27-387 | None |
| A0A6M0IRV1 | 32-466 | None |
| A0A259M5A0 | 218-693 | None |
| A0A5J4YSM7 | 99-572 | None |
| A0A2G5EHF2 | 9-269 | None |
| A0A388KW63 | 389-869 | None |
| A0A516AGH5 | 130-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.