DPCstruct | MC18506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4W818 | 101-172 | LMMIDGRYVIYGGDVNQDGAVDTADMTPVDNDASGFATGYLATDVNGDGTVDTGDMTIIDNNAAAFVSSITP |
| A0A351C241 | 1-75 | MLQLDSSPLRFGIYVGDPNKDGVVDVSDAGMVDNDASNFVGGYVLTDLNGDFVVDVSDAVFTDNNASNFVAKITP |
| A0A6L4YSR0 | 959-1030 | None |
| A0A7Y7TXX2 | 680-749 | None |
| A0A7Y7TZJ1 | 693-764 | None |
| A0A388PZU9 | 530-602 | None |
| A0A6L4YY95 | 669-732 | None |
| A0A2N2WF95 | 233-305 | None |
| A0A3C0BC07 | 246-317 | None |
| A0A3D4W5N2 | 33-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.