DPCstruct | MC18502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 19.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661W7C4 | 3-146 | LWGYAAGGQALVLNTPIQSINAIYTQAGLGTEQVLWEIAAASVACTVSGIYQGGVGARDGSTKDHTSGLENRFNAQVSHSSLGMTLE… |
| A0A1F8Q4C4 | 202-351 | GMYVLSMTGQAMARNSHIVWTDDPFCVNGAGTVENLYEVAGHAIIGSVCGYQQHGVGSTGGNKVDHHTGLEAGWQGEVGLATTRSGI… |
| A0A256YB35 | 364-510 | None |
| A0A497N8U8 | 328-478 | None |
| A0A832GSP2 | 2-137 | None |
| A0A7C1N5F5 | 66-215 | None |
| A0A832VY26 | 2-120 | None |
| A0A7C3SKX8 | 60-202 | None |
| A0A7J3J567 | 24-171 | None |
| X0V0J6 | 4-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.