DPCstruct | MC1850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090PD40 | 1-127 | MPAIGAPVMVLATLAMVVLPMPAFLLDLFFTFNIALSLVVLLVTVYTRRPLDFAAFPTVLLIATLLRLALNVASTRVVLLYGHEGPG… |
| A0A6V6ZQ09 | 7-137 | RSLFSPTVLLALALMAVIVMMILPMPAWVLDVGLATSFALAILIFTLTLFIERPLDFSSFPTILLASLMLRLSLNVSSTKLIIGQGH… |
| A0A2X2BJI5 | 10-145 | None |
| A0A2X2DCL2 | 8-155 | None |
| X1WNK7 | 143-275 | None |
| A0A2Y0NRF1 | 1-151 | None |
| C2VRI8 | 2-108 | None |
| A0A7Z0H3D2 | 376-508 | None |
| E8QXB3 | 20-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.