DPCstruct | MC185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M6ZWU1 | 2-56 | QQRYDIREEEDGMWTVFDIFTGLPAEVNGEILIGLDIQEADDAVDLMNAIDLKRR |
| G6YC41 | 27-90 | PGRDFTNRQYGRRVEADRSWTVYHVFTGIPAHEDGVAMTGLNRSDATRSMLSLNQRNAERRRVR |
| A0A6M7VE24 | 5-69 | None |
| A0A6M7WKU4 | 38-108 | None |
| A0A420A7U4 | 26-91 | None |
| A6UK93 | 26-105 | None |
| A0A7J4VJI0 | 11-73 | None |
| A0A2T5B322 | 7-64 | None |
| A0A1E4Y894 | 26-80 | None |
| A0A0Q8A6Z1 | 2-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.