DPCstruct | MC18493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 231 ± 40 aa |
| Standard deviation of domain lengths | 40.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418EVB4 | 42-286 | NKILHWDGTRESLGIGPDVIAALAIAAGFTIAFFGYKLIRPAMFVAGFAIGSVLCFVACEKIFREKAYVEAACWVAFALGGLIVGAL… |
| A0A078AVW9 | 169-376 | DNNAVALMLLIGMIGIFFCFFGYKYINISLFIGGLFIPVWIIWIFLYSVLINDNSKTWVGWVILFTSLLFGMIIGFVVVRLKKLGSF… |
| A0A417KFP4 | 11-213 | None |
| A0A1J0GM39 | 19-213 | None |
| A0A7R9L524 | 266-553 | None |
| A0A6S7FX31 | 14-234 | None |
| D0NCR5 | 2-235 | None |
| H9GM76 | 36-292 | None |
| A0A534IDX7 | 4-216 | None |
| A0A662WN83 | 36-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.