DPCstruct | MC18492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 275 ± 51 aa |
| Standard deviation of domain lengths | 50.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067BWV0 | 2-207 | VVLSTATLQLQTSGSLSHFATVRDPWYKTLLAANEVTWLITIVNDILLVATGPYAAHYVVLNGVLVWIVAAVISIWAPVTATLSVNL… |
| A0A418CIN4 | 626-924 | RDVVKFEGDRGAMTSMSARYPTTSWQPQASEIPRNVVNFLRMGVVYVTSVLAFVAGLVIMYTALGRGHIEPRNVFHVNRVAGFVWIG… |
| A0A6G0XRB5 | 15-345 | None |
| A0A6G0X4Q7 | 335-638 | None |
| A0A1W0A2Y6 | 1-280 | None |
| A0A1W0A097 | 43-314 | None |
| A0A1W0A005 | 239-482 | None |
| A0A1V9ZWE1 | 1-323 | None |
| A0A1V9YS04 | 344-626 | None |
| A0A1V9ZDJ2 | 64-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.