DPCstruct | MC18491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024UA99 | 2-142 | IRRLKEKWGMTYTSYEANWRMWASSILKLPVYQHDMHVANPPPEIMLHLFEPVPNGAQQRNQSLQRSMTVALDIVDSCLDGLGSLKR… |
| A0A418CAT8 | 51-182 | ENKASYANAPREWSSVHQAMVVQLKKKWGSVYHASEAAWRIWAAGILKKPLYLHAANVGMAPPSNVLPSLQRVLRVADKRLAQHNMH… |
| A0A6G0WVQ5 | 39-235 | None |
| A0A2P4X8M0 | 3-164 | None |
| A0A182G1D7 | 84-263 | None |
| A0A6G0S9Q6 | 4-127 | None |
| W2I7E1 | 109-243 | None |
| D0NZY7 | 21-144 | None |
| A0A1Y2CQE0 | 406-547 | None |
| A0A182G4K0 | 10-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.