DPCstruct | MC18488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RJ63 | 119-177 | TLDTPMNRKWMPKADTSTWTPLEYIAELFYKWIEDPSSRPTNGSVVKLTTTGGNTELSY |
| A0A819XPR1 | 79-137 | ILDTPMNHRSMPKADTSTWTPLEYIAELFYKWIDDPSSRPTNGSVVKLTTTGGNTELSY |
| A0A443SQI7 | 362-420 | None |
| A0A261XWR2 | 624-681 | None |
| A0A7R9EAD0 | 168-225 | None |
| S9VCN1 | 30-97 | None |
| A0A3F2RIT7 | 771-838 | None |
| K1R783 | 170-238 | None |
| A0A0C9LWR1 | 774-831 | None |
| A0A6A4T4H4 | 88-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.