DPCstruct | MC18486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 271 ± 77 aa |
| Standard deviation of domain lengths | 77.11 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535KJP8 | 1-218 | MKVAVLAGGTGGAALAAGIHTAIPGVDLTVVANTADDDEFWGLLVCPDIDAVIYRLAGVFNKHAGYGVNGDTFNVLGALAEIGEDTW… |
| F2UHS2 | 31-316 | IIRSFMIHFHTAVLTAASEQPGPNGEAVKAFCFHRGSVGNFFFSGCRKFFNSLSAAITLWSSLVGIPHETAVLPIINSNHTVTIGAQ… |
| A0A2V8IKY4 | 73-339 | None |
| A0A432QC91 | 146-490 | None |
| A0A7S4I2C5 | 1-254 | None |
| Q2GY82 | 27-433 | None |
| A0A847A0P7 | 39-261 | None |
| A0A093XMB9 | 251-661 | None |
| A0A662QN51 | 4-350 | None |
| A0A645J5U8 | 4-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.