DPCstruct | MC18481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2U5X0 | 1-73 | MDKWKDEELERMKIGGNKRLQEWFDARDVPRSATMQEKYNTKAAALYRDMIATEARGDKWNEATSPAQSWVPP |
| A0A183CQI4 | 1-74 | MDKWKEAELARMRAGGNAHAREFFESQPDFRPHWSIQEKYNSRAAALLRDKVATEADGRVWSYETSPARNYQPP |
| A0A803JRE8 | 267-351 | None |
| A0A7M4EDN6 | 64-152 | None |
| M7BUW2 | 138-211 | None |
| A0A6I9Z332 | 1-74 | None |
| A0A1S3IWR5 | 63-147 | None |
| A0A195CX09 | 825-909 | None |
| A0A4X2LMM5 | 64-148 | None |
| A0A7I8XP53 | 64-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.