DPCstruct | MC18480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 236 ± 19 aa |
| Standard deviation of domain lengths | 19.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18060 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5G425 | 165-389 | DGLKFFNDLCEKPFADQAVAFLNAYWAEVGPQAEFIFTVAYDVLRKADMHAKGVNYVHLYEEGNDLDFNIGLYFYEKLCKFVLDDDA… |
| F2U555 | 1-254 | MADSNEKKQKKQLTPEEIQEKFADVTNSTIDDQSQFFLRSFVTEFSGNFEEVLDLAEEFKKYAPDTGVVRELEEDKAHLFLERRGET… |
| A0A7S3PIE7 | 109-365 | None |
| A0A7S3Z9W5 | 1-243 | None |
| A0A058ZG15 | 55-274 | None |
| A0A7S3PNQ4 | 40-274 | None |
| A0A7S0DG62 | 72-315 | None |
| L8H398 | 4-250 | None |
| A0A7S2BC18 | 2-246 | None |
| N9UIJ7 | 3-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.