DPCstruct | MC18478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8YML2 | 7-82 | RMKVLSLYKSLLRESQKFSSYNFRMYALRKIRDEFREKKLLTDPARIKEEINFAEKNLGIIKRQVIVGNLYSTEKL |
| F2U1M6 | 1-77 | MRSQALSLYRRMLREAQGFVSYNVRSYAVRRVREGFRQAKGEADPAVLENMFSKAKEDLEMLKRQRVVYQLYAHPSG |
| A0A5P1FG12 | 10-98 | None |
| A0A194VLU7 | 4-81 | None |
| A0A2A6CRZ8 | 42-124 | None |
| A0A2R8MXG3 | 250-331 | None |
| A0A1E3J671 | 34-152 | None |
| A0A7D8Z378 | 1-105 | None |
| A0A8A3P217 | 9-104 | None |
| A0A2V5HSW0 | 6-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.