DPCstruct | MC18477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 538 ± 107 aa |
| Standard deviation of domain lengths | 107.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2TZK4 | 1-574 | MGDTMELREPLLSANQGYNHHADGGADGGSTHGVHAQDRNPDLQHDYHMPPRHEDSEPQSPRDGHNSRVFRNVGGMDEFFSRFYYYF… |
| A0A5E4N113 | 7-482 | FAIFRFMKLFNVAYHFSDIRAFYNVALHIPDKELENYTWREIVLKVLEAQKVQHMCIHKLDLTELDIYQRILRTKNYLIALVNKSVL… |
| A0A6I9XLE2 | 3-550 | None |
| A0A3R8BVW4 | 167-915 | None |
| W7TMH9 | 111-656 | None |
| A0A2X0MI22 | 327-981 | None |
| D3BQ47 | 15-571 | None |
| A0A7S1PGV2 | 98-684 | None |
| A0A7J0FS62 | 43-389 | None |
| A0A7M5V6W0 | 6-669 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.