DPCstruct | MC18476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 219 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2TYX0 | 31-261 | RDDVVKARSDWDKAVRFMKATLEKEYQETSRLLEEQKGPGWMRQWLTWSSPKAYQGAHSAMIAELSPYFQQSSKTGGVRAGITDEED… |
| A0A653CV19 | 215-440 | DRTIGDKRDWDQAVKFLESSVKAKLKESERTLKDLIGPSAKERWLYWQNQTEDQSKSRSVKNELDKILYSNDKHPPTLSYDELTTIK… |
| A0A0B1TAR1 | 1-253 | None |
| A0A444SUZ0 | 244-416 | None |
| A0A7R8D572 | 355-567 | None |
| A0A0R3QUZ0 | 149-402 | None |
| A0A819KX04 | 89-324 | None |
| A0A183HAX1 | 2-216 | None |
| A0A0N4XHQ6 | 5-175 | None |
| A0A8B6EEU1 | 35-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.