DPCstruct | MC18475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 196 ± 38 aa |
| Standard deviation of domain lengths | 37.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF04934- CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2B6S2 | 9-195 | NLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPL… |
| F2TXP4 | 2-213 | HIHANVLDYFGHPDSNPFYERESLNERQKQEGIDPERLKNYEGVEYAVSHAQDPVLQVIRKQLTQRGRPPKPLAYYYVARGNAFQAP… |
| A0A1R3HKT3 | 60-239 | None |
| D8LXV4 | 40-246 | None |
| A0A2S4WGV8 | 10-267 | None |
| A0A7R9TZ91 | 8-196 | None |
| A0A2S5B5N3 | 2-224 | None |
| A0A0F4Z2C8 | 382-600 | None |
| B8MTM7 | 1-232 | None |
| A0A3Q0INE8 | 3-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.