DPCstruct | MC1847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 147 ± 27 aa |
| Standard deviation of domain lengths | 27.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 65.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3D2Q7 | 1-105 | MKAGGSGLNPNAAAYVPLYKREADSAKPAAAAATHDVQHQPYGYGVQGKGSFPGSHMRDDDSEMEMEFLLASFSDLSDESIRDVYLA… |
| A0A5D2Z0W7 | 1-158 | MKPEVSSLNPYAASYIPLAKREGSIAKDIKPGNESAWFDPSSCSNASLESAIPGIGNHPVALKSDPGHGSLMQNQGEMSGEQIMDEE… |
| Q5XV46 | 1-116 | None |
| A0A067GJ18 | 1-140 | None |
| A0A4S4DJJ4 | 1-178 | None |
| A0A816M579 | 51-164 | None |
| A0A397Z1G9 | 1-173 | None |
| A0A5N5MDQ5 | 1-180 | None |
| Q9LYE5 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.