DPCstruct | MC18469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3QN84 | 16-89 | YTVPLPNNIDAYIAREVLPHVPDAWVDKSKTKVGYEIPLNRHFYVYEPPRPLEEIESDLQALEQEITDLLSDVV |
| A0A2N9JE65 | 19-110 | EPDTELRDTEQVPLTEAAGEYADGIEAFFRREVEPYAPDAWIDETKTKIGYEISFTRHFYKPTTMRTLAEIQADIRALEAETDNLIA… |
| A0A251Z677 | 1-73 | None |
| A0A3B8PTH4 | 153-217 | None |
| A0A661PVP4 | 150-248 | None |
| A0A431IQJ8 | 78-175 | None |
| A0A1G8ZYG4 | 27-95 | None |
| A0A1V6DH73 | 11-99 | None |
| C4K961 | 284-356 | None |
| A0A4R7GGS6 | 103-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.