DPCstruct | MC18468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1ADN0 | 560-650 | CTNATWKQMVGLLLARTDIVLMDLTSFSAARHGSKWELQALADQVPLERVALLVNTDTDLTFLGGLLANIRTRLADDSPNRGRDVTW… |
| A0A2N9JE47 | 22-115 | LCHGSYWQRAVTRLLLEVDQVFLDLTGFHPDHRGTAFELQAALDLVDVGRLRLIAGAECDQLFLVAQLRAAWRAMLPGSPNARSGSR… |
| A0A7V8VQ10 | 466-564 | None |
| A0A536T3P7 | 4-99 | None |
| A0A2E4HGZ3 | 349-460 | None |
| A0A3C1NGT0 | 120-214 | None |
| A0A353YHI8 | 713-821 | None |
| A0A2S7KSW7 | 1-114 | None |
| A0A2N9JGQ9 | 292-408 | None |
| A0A7W0GMD7 | 28-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.