DPCstruct | MC18467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 54.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287M6Y2 | 1-103 | RTRSLTEVDLEELKGCLDLGFGFSYHQIPVLCGTLPGLELCYSMTRRFLDEQRAVVGQLEPAAPAAPPIPDWKISGPGDNPEEVKAR… |
| I1JRN6 | 62-176 | TRTRRNSFHDNVTDDDLHELKGCIELGFGFNEENGQKLCNTLPALDLYFAVNRQLSSVSTPHSRPSSSFGSPVSSAPPPDSDSWKIC… |
| D8RME7 | 1-126 | None |
| D8RAQ7 | 112-214 | None |
| A0A0E0R705 | 189-296 | None |
| A0A0E0MKV6 | 24-130 | None |
| A0A811RD87 | 106-218 | None |
| A0A218XSY9 | 73-190 | None |
| A0A1D6IX94 | 412-514 | None |
| A0A6G1BWV0 | 102-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.