DPCstruct | MC18466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287IW21 | 209-284 | KISEKVKPHPLVITALTQVEDVIPKWKIVPTKDVIDAAFKDPDKREKIRKNKLIYQDKPRLKTALEMLRTSMYVEG |
| A0A287M3M9 | 1-72 | MRPHPVVVSALKMICAVVPSWRVIPAPDQLDKVCKDPQFKKEIRSNPYMYKGNIALQTGHELLAVSLDIEKN |
| A0A4S4DYS5 | 104-193 | None |
| A0A368PHV4 | 104-181 | None |
| A0A7J0E6U8 | 37-111 | None |
| A0A7G2ETM9 | 379-454 | None |
| A0A0K9PZE7 | 3-92 | None |
| A0A5N6QQN0 | 81-156 | None |
| A0A3P5Y7D8 | 428-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.