DPCstruct | MC18465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 2.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 72.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0X8P1 | 2-57 | QEPYPSVKNILLLDSEGKRVAVKYYADDWPTQAAKLAFEKSVFTKTQKTNARTEAE |
| A0A287M3I0 | 36-91 | MAPCPSVKNILVLDAEGKRVAVKYYADDWPSASSKMAFEKSLFVKTQKTSARAEGE |
| A0A453FW48 | 2-60 | None |
| A0A6A1VZI7 | 531-586 | None |
| A0A6A3CEY2 | 301-358 | None |
| A0A438JNX6 | 1-56 | None |
| A0A1R3JMR5 | 1-64 | None |
| A0A2P2KAF0 | 8-62 | None |
| A0A176WE36 | 120-174 | None |
| A0A7N2LN11 | 48-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.