DPCstruct | MC18464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287M0H4 | 2-106 | FDMEYARWLDDDGKRLAELRGGLQAHLADSNLGAVVEECMQHYDELFQLKAELARSDVFHLLTGAWATPAERCFFWMGGFRPSELLK… |
| A0A833QFQ5 | 2-98 | FDMEYARWLDESHRHINDLRGGLATHLSDGDLRIIVDECLTHHDELFQLKAVAAKADVFHLITGLWATPAERCFLWMGGFKPSELIK… |
| A0A444CBN8 | 2-111 | None |
| A0A4D9B9F2 | 33-124 | None |
| A0A7J6W9I4 | 4-141 | None |
| A0A7J8QE66 | 147-233 | None |
| A0A2Z6N6P7 | 260-366 | None |
| A0A426ZJA9 | 21-114 | None |
| A0A3L6G920 | 31-171 | None |
| A0A6V7NH31 | 129-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.