DPCstruct | MC18462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 236 ± 39 aa |
| Standard deviation of domain lengths | 39.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FSZ2 | 73-268 | LDNLITELLLWLLDERVPLMDDGSQLLKALNVLMLKILDNAERTSSFVVLINLLRPLDPSRWPSPTPSESLAVKNQKFSDLVVKCLI… |
| A0A287LVS7 | 9-254 | SQLLKALNVLMLKILDNAERTSSFVVLINLLRPLDPSRWPSPTPSESLAVKNQKFSDLVVKCLIKLTKVLQSTIYEVDLDRILQSVH… |
| A0A446Q3P2 | 182-442 | None |
| F9WB51 | 67-314 | None |
| A0A2J6JP81 | 50-301 | None |
| A0A7S0NAS6 | 256-513 | None |
| A0A7S0BIP8 | 10-270 | None |
| A0A1Y1XWM9 | 46-305 | None |
| A4I5K3 | 1496-1706 | None |
| A0A7S4JT94 | 2-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.